General Information

  • ID:  hor006765
  • Uniprot ID:  Q8WMR3
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  CGA
  • Organism:  Cervus nippon (Sika deer)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cervus (genus), Cervinae (subfamily), Cervidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  FPDGEFMMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTDCHCSTCYYHKS
  • Length:  96(25-120)
  • Propeptide:  MDYYRKYAAVILAVLSLFLQILHSFPDGEFMMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTDCHCSTCYYHKS
  • Signal peptide:  MDYYRKYAAVILAVLSLFLQILHS
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-86; 36-88; 63-91
  • Structure ID:  AF-Q8WMR3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006765_AF2.pdbhor006765_ESM.pdb

Physical Information

Mass: 1250223 Formula: C467H725N127O138S15
Absent amino acids: W Common amino acids: CK
pI: 8.41 Basic residues: 16
Polar residues: 37 Hydrophobic residues: 21
Hydrophobicity: -43.85 Boman Index: -15799
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 38.65
Instability Index: 4582.6 Extinction Coefficient cystines: 8075
Absorbance 280nm: 85

Literature

  • PubMed ID:  NA
  • Title:  NA